PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_71128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 139aa    MW: 16517.9 Da    PI: 9.647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_71128.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM187.23.6e-5861331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhPtdeel+ +yLk k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s 
  MLOC_71128.1   6 LPPGFRFHPTDEELIIYYLKSKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS- 100
                   79****************************.99**************95334455777**************************************. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++++vg+kktLv+y+grap+g++tdWvmheyrl
  MLOC_71128.1 101 QKRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                   9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-614137IPR003441NAC domain
PROSITE profilePS5100557.0646139IPR003441NAC domain
PfamPF023657.1E-317133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKSKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QKRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-56213311140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649289.19e-97PREDICTED: NAC domain-containing protein 86-like
RefseqXP_015628522.12e-98PREDICTED: NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI51e-86NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM0YNG01e-101M0YNG0_HORVD; Uncharacterized protein
TrEMBLM8BNT49e-98M8BNT4_AEGTA; NAC domain-containing protein 78
TrEMBLW5E7G94e-97W5E7G9_WHEAT; Uncharacterized protein
TrEMBLW5EKA65e-97W5EKA6_WHEAT; Uncharacterized protein
STRINGMLOC_71128.11e-101(Hordeum vulgare)
STRINGOB03G11530.13e-96(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-91NAC domain containing protein 28